SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056527 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056527
Domain Number 1 Region: 898-1078
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.78e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 1053-1174
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 191-221,314-443
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 32-185
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056527   Gene: ENSBTAG00000005760   Transcript: ENSBTAT00000066234
Sequence length 1304
Comment pep:known chromosome:UMD3.1:12:50679632:50888598:-1 gene:ENSBTAG00000005760 transcript:ENSBTAT00000066234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGTPAQPGPGKPSDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVLLVLSAPFLRCIPAPGAGATGGSGSTAAQPNPAVFIFE
HKAQHISRFIHNSQDLTYFAYLIKAQPDDPESQMACHVFRAADPNQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGRVTVTHKKAPSSLIDDCIEKFSLHEQQRLRLQ
SEPRAGDSGEDQAGSEARTPACPVDVLSEEGDGVADTHPVFPAAPSQPGPSSSRVCFPER
ILEDSGFDEQQEFRSRCSSVTGVLQRKVHENSQKPQPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESSEPGLSQYICYVF
QCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKL
VIQRHLSSLTDNEQADIFERVQKMKAVNDQEENELVILHLRQLCEAKQKTHVHIGEGPLT
ISNSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSV
ASEKDYSPGDSPPGTPPASPLSSAWHTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQD
GKAHGVRSPLLRQSSSEQCSILPPARRMHKECNSSSSLPSLHTSFSAPSFTAPPFLKSFY
QNSGRLSPQYENEISTRQDTASESSDGEGRKRTSSTCSNESLNAGGTPVTPRRVSWRQRI
FLRVASPMRKSPSAMQQEKDGLDRSELLPLSPLAPTMEEEPLMIFMSDEDDPEKGEERNK
SEELRCLWRKAIHQQILLLRMEKENQKLEGASRDELQSRKVKLDYEEVGACQKEVLTIWD
KKLLNCRAKIRCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKE
LLKQLTAQQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFV
AGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLE
ENEISPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSNQETLIMEC
ENFENIVEFLKITLPDMNSSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACE
DSEPIEKLERANSQLKRQNMDLLEKLQIAHAKIQTLESNLENLLTRETKMKSLIRTLEQE
KTAYQKAVEQIWKLLPADILANCEPLLRDLNCNPNNKAKTGNKP
Download sequence
Identical sequences G3N3M2
ENSBTAP00000056527 ENSBTAP00000056527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]