SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056532 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056532
Domain Number 1 Region: 54-137
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000451
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056532   Gene: ENSBTAG00000047374   Transcript: ENSBTAT00000065587
Sequence length 138
Comment pep:known chromosome:UMD3.1:5:56217962:56220534:1 gene:ENSBTAG00000047374 transcript:ENSBTAT00000065587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTWVAVVTLSVDLGLAVGVVFSMMTVVCRTQRVQCLALGLAEGTELYRPLRESHKLLQV
PGLCILSYPAPLYFGTRGQFHRVLEWHLGLGEGRKEAPKTDGPPDAAAEPVRVVVLDCSG
VTFADAAGAREVVQVRER
Download sequence
Identical sequences G3N3M7
ENSBTAP00000056532 ENSBTAP00000056532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]