SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056579 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056579
Domain Number 1 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 292-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 242-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 400-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 19-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 8 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000311
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 468-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000189
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 219-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000311
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056579   Gene: ENSBTAG00000047761   Transcript: ENSBTAT00000065944
Sequence length 691
Comment pep:known chromosome:UMD3.1:18:58636530:58650937:-1 gene:ENSBTAG00000047761 transcript:ENSBTAT00000065944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPEEETLKRRKKKEQESGMALSQAQLTFKDLAIEFFQEEWECLDLAQRALYRDVMVEICE
ELVSLSLCKKCCGTFMTKELLQKKYINNRELYQPVVLGRFGNHGIEESDFSEVWGNTFEF
ENKCGYAGRNSKGTLMANNINLTGRKGEQDSKPRIDLPLKPSVSLSHEKMLSFFKKKYII
GIEKSIKTCSSILSLQRFPPSVKTNISNKYGKPSLCTQQQKTNIRGKLYKCNDCGKTFSI
QILVSHQRIHSEQRPYKCNECSKAFKQFSNLTRHQRIHIGEKPYKCNICDKNSHLTNHWR
IHTEEKPHKCNECGKAFTKRSELWLHERIHTGEKPYKYNEYGKSFTKRSYLWDHERIHTG
EKPYKCVEYSKVFRQWSTLRIHQRIHTGEKPYKCNESGKAFKQCSHLTNHQNVHPGEKPH
KCTVCGKAFIHISSLVKHQKIHTEEKPYKCNAFIQCSSLIEQQSIHTGEKPYKCNECGKP
SPLMKHKRNHTREKPYKCHECDKAYTKFVQLTRHQKIITKKKHVESNILDNAFSQSSSFE
AHQRIHGREEPYKCNECGKSFNWGSHLTRHQRIYMGEKPYKCNICSKAFSQNSNFRIHQR
IHTGEKPYKCNECGKAFKQYSSLTRHQNIHPEEKPHKRNVCDKAFIKCSNLWGHERTHTR
EKSYKCTECGKGFGQWSDFRIHQRIHTGEKA
Download sequence
Identical sequences G3N3S0
ENSBTAP00000056579 ENSBTAP00000056579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]