SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056607 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056607
Domain Number 1 Region: 1179-1272
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000128
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056607   Gene: ENSBTAG00000009575   Transcript: ENSBTAT00000065447
Sequence length 1306
Comment pep:known chromosome:UMD3.1:9:30195129:30400435:1 gene:ENSBTAG00000009575 transcript:ENSBTAT00000065447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHFSGEDEAMLQAMLRQLFQSVKEKITGAPSLECAEEILLHLEETDENFHNYEFVKYLR
QYICNTLGSMIEEEMEKWTSEQNQGEEFGYDTVVQHVTKRTQESKEYKEMIHSLKNIMKI
VVESMINKFEEDEIRSQERQKKIQKEKSSSYCTDNCSDSDSSFNQSYKFCQGKLQLILDQ
LDPGQPKEVRYEALQTLCSAPPSDVLNCENWTTLCEKLTVYLSDPDPVFSDRILKFYAQT
FTLSPLHMTKEIYTSLAKYLELYFLSRENNIPTLSTGIDISNPNVTHLLKKIRLLNEYQK
EAPSFWIRHPEKYMEEIVESTLSLLSVKHDQSHLVSQKILDPIYFLALVDTKAVWFKKWM
HAYYSRTAVLRLLEKKYKSLITTAVQQCVQYFELCETMKGDEVLGHSKSCGIKQKTFYYS
GQELQYIYFIHSLSLLGRLLIYTQGRKLFPVKLKTRKEDSVSLTDLLVLFTQLIYHSPTC
PKMTSPGHLEDYSPASMATEVLCILCDQKECAIECLYNNTVIEALLQPIRNLMKGTKAAP
NCSETALIHIAHILARIASVEEGLTLLLYGENMNSSEEKSPTGAHLIAQFSKKLLDEDIS
IFSGSEMFPVVKGAFSSVCRQIYGTCEGLQVLIPYSLHESIAKAWKKTSLLSERIPTPVE
GSDSVSLVSQESQNIMAWEENLLDDLLNFAATPKGLLLLQRTGAINECVTFMFNQYAKKL
QISRHKKFGYGVLVTQVASTAAGAIALRNSGFINALITELWANLECGRDDVRVTHPRSTP
VDPIDQSCQKSFLALVNLLSYPAVFELVGNQSLPNKAEYSLREVPTSVIDIIDRLIILNS
EAKIRSLFNYEQSHIFGLRLLSVVCCDLDTLLLLEAQYQVSELLLNAQEENTLETSESHR
EFIIDSLSVERNHVLVRINLIGGPMERILPPRLLEKGDEPYPWPMFSSYPLPNCYLSDSV
TRSTDLKQGQNDLANTKSCFKGASDNGSKWVGECKVVFVKRKKTMLKMNHAETLVELLEK
FVLHLSESPSECYFPSVEYTATDANVKNENLSSVQQLGIKMTVRYGKFLNLLKDGAENDL
TLVLKHCERFLKQQQASIKSSLHILFCLQRNYTSHDWFVSSLFIIMLGDKDKTFQFLQQF
SRLLTSAFLWLPRLHISRYLPIDTIESGIHPVYFCSTHYIEMLLKAEVPLVFSAFHMSGF
APSQICMQWITQCFWNYLDWIEICHYIATCVFLGPDYQVYICIAIFKHLQQDILQHTQTQ
DLQVFLKEEALHGFRVSDYFEYMEVLEQNYRPVLLRDMRNMRVQST
Download sequence
Identical sequences G3N3U5
ENSBTAP00000056607 ENSBTAP00000056607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]