SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056617 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056617
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 6 Region: 387-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056617   Gene: ENSBTAG00000047718   Transcript: ENSBTAT00000065380
Sequence length 448
Comment pep:known chromosome:UMD3.1:17:73195725:73197071:-1 gene:ENSBTAG00000047718 transcript:ENSBTAT00000065380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEIPPAAKLGEAFVFAGGLDMQADLFAEEDLGAPFLQGRALEQMAVIYKEIPLGEQGGEQ
DDYRGDFDLCSSPVPPQSIPPGDRAQDDELFGPTFLQKSDPTAYRITGSGEAADAPAREA
VGRGDLGLQGPPRTAQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECGECGKAFSQ
SSHLLRHQAIHTGEKPYECGECGKAFRQSSALAQHAKTHSGRRPYACRECGKDFSRSSSL
RKHERIHTGEKPYACQECGKAFNQSSGLSQHRKIHSLQRPHACELCGKAFCHRSHLLRHQ
RVHTGKKPYACADCGKAFSQSSNLIEHRKTHTGERPYRCHKCGKAFSQSSALIEHQRTHT
GERPYECGQCGKAFRHSSALIQHQRTHTGRKPYVCNECGKAFRHRSALIEHYKTHTRERP
YECNRCGKAFRGSSHLLRHQKVHAADKL
Download sequence
Identical sequences G3N3V4
ENSBTAP00000056617 ENSBTAP00000056617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]