SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000545 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000545
Domain Number 1 Region: 40-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 96-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 210-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 152-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 263-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000545   Gene: ENSBTAG00000040568   Transcript: ENSBTAT00000000545
Sequence length 312
Comment pep:known chromosome:UMD3.1:25:37431778:37469998:-1 gene:ENSBTAG00000040568 transcript:ENSBTAT00000000545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKPYECNECGKAFNQSTYLIQHHRIHTGEKPYKCKECGKAFNDTSSLIKHQRVHTGEKPY
GCKECGKAFSDRSGLTQHQRTHTGEKPYECSECGKAFSYCSALIQHQGTHTGEKPYKCHE
CGKAFSDRSALIRHQRIHTGEKPYKCKECEKAFSQSSSLTKHLRTHTGEKPYKCNDCDKA
FSQSSSLIQHQKTHAGEKRYKYKKFGENCRASNFIQHRRIHTGEKPFKCGECGKSYNQRV
HLTQHQRVHTGEKPYTCQECGKSFIQSAHLIQHQRIHTGEKPFRCDECGKSYNQRVHLTQ
HQRVHTGEKPYT
Download sequence
Identical sequences F1MBS2
ENSBTAP00000000545 ENSBTAP00000000545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]