SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000688 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000688
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 5.89e-28
Family BTB/POZ domain 0.0065
Further Details:      
 
Domain Number 2 Region: 288-380
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000817
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000688   Gene: ENSBTAG00000000529   Transcript: ENSBTAT00000000688
Sequence length 385
Comment pep:known chromosome:UMD3.1:23:12405340:12462065:-1 gene:ENSBTAG00000000529 transcript:ENSBTAT00000000688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLEDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSNENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
IRVIDHSQYLCRSWQKLYFPARVCR
Download sequence
Identical sequences F1MS09 L8HWW6
ENSBTAP00000000688 9913.ENSBTAP00000000688 ENSBTAP00000000688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]