SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002117 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002117
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-36
Family SCAN domain 0.00000505
Further Details:      
 
Domain Number 2 Region: 315-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000615
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002117   Gene: ENSBTAG00000001614   Transcript: ENSBTAT00000002117
Sequence length 349
Comment pep:known chromosome:UMD3.1:25:2835245:2841856:1 gene:ENSBTAG00000001614 transcript:ENSBTAT00000002117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKMEITLSSQSHIQAFSKQERHIIAKLEEKREPALQEDWPDPELSRQSFRRFCYQEAS
GPQEALSHLRQLCRQWLQPEVHTKEQILELLVLEQFLNILPAEIQARARHRCPVSSKEIV
TLVEDFHRAAKGPKQWVAVCMEGQKVLLEKTGSQLGEQELPDFQPQTPRRYPREETFQAG
SQDQRSPPHWEKSLLLQEPTSRLAETETPRTKSDNKENPQQEGAKGAKPCVLSVGRPKGS
GLQSPEPRGASLSEPRLSQRQFSTPSAQKPFAHYQRHCRELEYIGAPLKSHPLRELKKSK
GSRRSLSNHLQRLSHQPARSAKKPYKCDECGKSFTWNSELKRHQRVHTG
Download sequence
Identical sequences Q3SZL2
ENSBTAP00000002117 NP_001030278.1.59421 NP_001030278.1.76553 ENSBTAP00000002117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]