SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002174 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002174
Domain Number 1 Region: 276-364
Classification Level Classification E-value
Superfamily EF-hand 1.26e-22
Family Eps15 homology domain (EH domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000071
Family G proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002174   Gene: ENSBTAG00000007361   Transcript: ENSBTAT00000002174
Sequence length 367
Comment pep:known chromosome:UMD3.1:29:43704113:43708218:-1 gene:ENSBTAG00000007361 transcript:ENSBTAT00000002174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQ
QLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPR
NAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQ
ISPGDFPNLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPAQ
VVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANA
KKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVP
PSKRRHE
Download sequence
Identical sequences F1N6N3
ENSBTAP00000002174 ENSBTAP00000002174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]