SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003218 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003218
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily Nudix 2.84e-28
Family MutT-like 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003218   Gene: ENSBTAG00000002480   Transcript: ENSBTAT00000003218
Sequence length 158
Comment pep:known chromosome:UMD3.1:25:41522214:41527685:-1 gene:ENSBTAG00000002480 transcript:ENSBTAT00000003218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMCASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVHEGETIEDGAKRELQEESG
LTVDALHKVGQITFEFVGDPELMDVHVFCTDRVQGTPVESDEMRPQWFRLDQIPFGDMWP
DDSYWFPLLLQRKKFRGYFRFQGQDTILDYTLHEVDAV
Download sequence
Identical sequences F1MLL8
ENSBTAP00000003218 ENSBTAP00000003218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]