SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004721 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004721
Domain Number 1 Region: 437-683
Classification Level Classification E-value
Superfamily vWA-like 2.37e-70
Family Trunk domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 2 Region: 198-454
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 8.89e-37
Family beta-sandwich domain of Sec23/24 0.0043
Further Details:      
 
Domain Number 3 Region: 685-780
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.09e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 887-1028
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.18e-31
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 781-886
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.53e-29
Family Helical domain of Sec23/24 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004721   Gene: ENSBTAG00000003619   Transcript: ENSBTAT00000004721
Sequence length 1032
Comment pep:known chromosome:UMD3.1:6:7651891:7761965:1 gene:ENSBTAG00000003619 transcript:ENSBTAT00000004721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQVYVATPPYSQSQPGIGLSPPHYGHYGDPSHAGSPPGMIKPAGPLGAAPPGGMLPQG
HPPPGPHQFGQNGAHAQGPPPQRFPGPPPVNSAAPAYPPYSPSTQSSYPSPGSTSSVAQL
GSQLNAMHINSYGSGVAPPSQGPPGPVSAASFQGPPQPPQPSILQPGSQILPPPPTALNG
PGASPLPPSTHRADGLPGPAPPNAQYQPTPLPGQTLGPGYPAQQANYGPPVAGAQLSYPG
GFPGGPAQMAGPPQPQKKLDPDSVPSPIQVIESDRATRGGQVYATNARGQIPPLVTTDCV
IQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAIIKPFATIPSNETPLYLVNHGEAGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLEKLPKEDQEET
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVSEVFVPLLDGFLVSYRESQSVIHNLL
DQIPEMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
MINTDKEKILFQPQTNIYDSLAKDCVAHGCCVTLFLFPSQYVDVASLGLVPQLTGGTLYK
YNSFQMHLDSQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIYMNNTTDVEMAA
IDCDKAVTVEFKHDDKLSEDTGALIQCAVLYTTVSGQRRLRIHNLGLNCSSQLADLYKSC
ETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
VLPVYMNCLLKNCVLLGRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
TLPAAIRCSETRLSEEGIFLLANGLNMFLWLGVSSPPELIQGIFNVPSLAHVNTDMTLLP
ELGNPYSQTLRMIMGIIQQKQPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFL
CCVHKEICQLLN
Download sequence
Identical sequences F1MV07
ENSBTAP00000004721 ENSBTAP00000004721 XP_002688104.1.76553 XP_015319175.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]