SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004858 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004858
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily DEATH domain 2e-20
Family DEATH effector domain, DED 0.0056
Further Details:      
 
Domain Number 2 Region: 112-189
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000294
Family DEATH effector domain, DED 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004858   Gene: ENSBTAG00000003731   Transcript: ENSBTAT00000004858
Sequence length 192
Comment pep:known chromosome:UMD3.1:2:90214945:90219273:1 gene:ENSBTAG00000003731 transcript:ENSBTAT00000004858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSQSLNSTLDDNRRVNFREKLLIIDLSLENRDVECLKFLCQDYITLGKLEKCRRALD
IFEYLLQQELLSEEDPVFLAELLYIIEQKILLKHLDYTKEQVECWLQTRRRVSHFRNLLY
ELSEGISSENLQSMIFLLNESIPNVQMTSRSFLMCLEKQAKIDEDNVTLLENLCQKIVPN
LMEKLHKYKRER
Download sequence
Identical sequences E1BCG6
9913.ENSBTAP00000004858 ENSBTAP00000004858 ENSBTAP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]