SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004948 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004948
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.96e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000217
Further Details:      
 
Domain Number 2 Region: 124-298
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.01e-43
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0005
Further Details:      
 
Domain Number 3 Region: 601-708
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.27e-25
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000501
Family TGS domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004948   Gene: ENSBTAG00000003799   Transcript: ENSBTAT00000004948
Sequence length 718
Comment pep:known chromosome:UMD3.1:3:20234451:20246077:-1 gene:ENSBTAG00000003799 transcript:ENSBTAT00000004948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRCRRLRFPGLHACGLHTAAVPTPPHWLVERLGYFEELWTAQVKRLASMTQEEQRT
IKISLPGGQKVDAVAWKTTPYQLAQQISSNLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSAQGKKVFWHSSTHVLGAAAEQLLGAVLCQGPSTECGFYHDFFLGKERTVKGSELPV
LERFCQELTAAAQPFRRLEASRAQLRQLFKDNPFKLRLIEEKVTGPTATVYGCGMLVDLC
RGPHLRHTGQIGGLKLLSNSSSVWKFPDAPETLQRVSGISFPTAEELRAWEEWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIKAEYTRRGFSEVKTPTLFSAK
LWELSGHWEHYREDMFALQPPGLDRPSSSQSDHSASPHTDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGSLGGLTRLRCFQQDDAHIFCAPDQLEAEIRGCLDFLH
SVYTILGFSFHMALSTRPSGFLGEPCLWDQAEQVLQQALEEFGAPWDISPGDGAFYGPKI
DVHVRDALGRPHQCGTIQLDFQLPLRFDLQYKGQLGALERPVLIHRAVLGSVERMLGVLA
ESCGGKWPLWLSPFQVVVIPVGTEQEEYAREAQQSLRAAGLVGDLDADSGLTLSRRIRRA
QLAHYNFQFVVGQREQSKRTVNIRTRDNRRLGERDLAEAVQRLLELQDTRVPNAEEIF
Download sequence
Identical sequences F1MX06
ENSBTAP00000004948 ENSBTAP00000004948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]