SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005744 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005744
Domain Number 1 Region: 534-635
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-23
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005744   Gene: ENSBTAG00000004377   Transcript: ENSBTAT00000005744
Sequence length 640
Comment pep:known chromosome:UMD3.1:18:52001352:52046563:-1 gene:ENSBTAG00000004377 transcript:ENSBTAT00000005744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRSRPDLGAPPAAVPECDTEVRSQGASKPQGHPKDSREPEAPEAPAELPSGQGAEQQA
KEEEEVGEGSSTESSHDAAEAPSPVQTPATTPAPALSGEGVRGAARRLRAQQLEALTRVA
LMEQRVKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQVDSEKGGQ
EQREQEQRRLSQERDRVEGLRQRLQEAQEQLDSQPEDQHERLLQGMQEMREQLDVAQRAY
EDLEFQQLERESRQEEEDRDSPGASVPDPKVQELQASVAQHRRRIQVLEEQLKSLGEQMA
AESRGLSRKKEEALQALTQERSRLLELNCLQGTPGGDFSEPNQALTKLLFTQKTDRQLLV
LQDPTAHTAAATSSCLFSVHSSLQGSIGLQRTGSLSRKRGERASQRGCPRPLSLHCSGSL
EASALPPEAGDSGRHPLYQLLNCGPRNRSLWPQFPRLERLLQQAVAERERLLQAREGTRR
SKEGSSGPPVPAIMAPPAPPSSPAGPRVLDLRQHLERWGHNPENCPHLRVSGGCCRGPLV
KMGGRIKTWRKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNP
RLTFCVKTYERLFYMVAPSPEAVRIWMDVIVTAADENHAP
Download sequence
Identical sequences F1MSN5
ENSBTAP00000005744 ENSBTAP00000005744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]