SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006288 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006288
Domain Number 1 Region: 35-311
Classification Level Classification E-value
Superfamily L domain-like 1.97e-57
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 241-477
Classification Level Classification E-value
Superfamily L domain-like 2.72e-41
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 3 Region: 542-850
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.86e-20
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006288   Gene: ENSBTAG00000004789   Transcript: ENSBTAT00000006288
Sequence length 943
Comment pep:known chromosome:UMD3.1:16:70932238:71016271:1 gene:ENSBTAG00000004789 transcript:ENSBTAT00000006288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPRLLPLWLCAAALCAPPAAPPPRPRPGCPVPCRCREAGILLWVDCSERGLSTVPAG
LDPLTAYLDLSMNSLTELWPGVFHHLRFLEELRLSGNRLAHIPGQAFSGLSSLKILMLQN
NRLGGIPAEALWELPGLQSLRLDANLISLVPDRSFEGLTSLRHLWLDDNALTEIPVRALS
HLRALQAVTLALNRIGRVPDYAFWNLSSLVVLHLHNNRIRHLGAHSFEGLQNLETLDLNC
NQLHEFPVAIQTLGRLQELGFHNNNIRAIPEKAFLGNPLLQTIHFYDNPIQFVGRSAFQH
LPGLHTLSLNGATDIQEFPDLRGTTSLESLTLTRAGLQRLPPGMCQQLPRLRVLELSHNL
IEGLPSLRGCQKLEEIGLQHNRIWEVRADTFRELTFLRSLDLSWNAIRSIHPEAFSTLRS
LVKLDLTGNQLSVLPLAGLGGLVHLKLRGNRALSQAFPKDSFPRLSPRTLEVPYAYQCCA
YSGCPGFFTASGLRGPQHPPPDAQDPPKRTLADRAESRYDLDPEELQLEMEEPRPQPAVQ
CSPAPGPFQPCEHLFESWGVRLAVWAVVLLALLCNALVLLSLSVAGPGPLPPAKFVVGAL
AGANALTGLSCGLLASVDALTFGQFAEFGARWEAGPGCRAAGFLAVLGSEASVLLLSLGA
AHCSVAAACVRAHGKAPAAGSVRAGALGCLALAGLLAALPLASVGEYGASPLCLPHAPPA
GRPAALGFAVALVLLHAACLLAAALACIRLSCRLPAAGLEASWDCAAVRHVAWLTFADGL
LYCPVAFLSLASALGLLPVTPEAVKAVLLLVLPLPACLNPLLYLLFSPHSREDLRRLRPC
WGGPREPSSCDSTQALVAFPDVELTAEASETQGLPLGALVPRQQPGGLKLEGGHVAEPEG
TRFGQQPPSRDGGRAQGTPEASLAGRGRAGGGGFQSSGLASGV
Download sequence
Identical sequences G3X6G8
ENSBTAP00000006288 ENSBTAP00000006288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]