SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007319 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007319
Domain Number 1 Region: 938-1043
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-29
Family PDZ domain 0.00086
Further Details:      
 
Domain Number 2 Region: 436-541
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-24
Family Second domain of FERM 0.00073
Further Details:      
 
Domain Number 3 Region: 542-646
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-24
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 4 Region: 759-863
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-23
Family PDZ domain 0.013
Further Details:      
 
Domain Number 5 Region: 1065-1173
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-22
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 341-431
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000126
Family First domain of FERM 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007319   Gene: ENSBTAG00000005568   Transcript: ENSBTAT00000007319
Sequence length 1312
Comment pep:known chromosome:UMD3.1:28:42939762:43003209:-1 gene:ENSBTAG00000005568 transcript:ENSBTAT00000007319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCHMCVFAGMSPASVTLASALQVRGEALSEEDIWSLLSLATERLLEDLCDDSSNYVVCPW
SVLLSATGSLSFQDHVSHIEAAPFKAPELLQGQSNDEQLGASQMHVYSLGMTLYWSAGFH
VPSNQPLQLCQPLHSILLTMCEDQPGRRLPLQSVLEACQIHWEEAAVHPTSANLHVRQLV
GLVLGTISEVERRAVEESSSGQRDRSHLLRNRLHQASCESQAAWALGCAHRCRVSERSTE
TQSSLEPGLNTSARGRCSLAVNSALPVQVPPDLQEGRRLSSASALPENSQPATPSQRGFL
QRKGKFSRPEFVLMAGEAPVTLYLPGSIVTKRAKSYLALRDLCVVLLSGQCLEVKCDITS
TVGAVFSAIASFASLGELTYFGLAYMKGKEFFFLDAETRLCKIAPEGWSEQPQKKSSPNA
FVLFLRIKFFVSHYGLLQHSWTRHQFYLQLRKDILEEKLYCSDETLLQLGVLALQAEFGS
YPEEQVENKAYFRVEDYIPASLIERMTALRAQVEVSEMHRLSPMLWGEDAELEFLRVAQQ
LPEYGVLVYQVLPEKTRLEGEMALGICAKGVIVYEVRNNSRIATLRFQWREIEKILAYRK
KFIITSSVTGKKHTFVADSVKTCKYLLGLCCAQHGFNAQMSSPGVTSGIIISDSDKCVQM
ASLSLAHLAQSNQLTWIQRLSSSENALFIPGLEDAAGGLLRRSLDNFTMDTSKGTRAQGL
RGSPCLGREQLERLCLIQKPTTCDLLSRQPAQSMRTDLGSRNNRRRSFIAEPDGEIVHVT
LSRDPHRGFGFVINEGEDVGKVDPGIFISSIIPGGPAEKAKKIKPGGQILALNRISLEGF
TFDMAVRMIQNSPDNIELIISQSKGVCGNTSSEEKNSTANSGVCSTDSLSNGHQGSLSSH
TQDRERNIEELEMAQTQSVMPGLSPQLSALPLKGAGSSCPPSPSETNASEIYFVELVKED
GTLGFSVTGGINTSVFCGGIYVKSIVPGGPAAKEGRILQGDRLLQVDGVSLCGLTHKQAV
QCLKGSGQVARLVLERRGPRIAQHCPSANDRMGEECTAVSLATVLPGRPASSVSATDGPK
FEVKLKKNASGLGFSFVQMESEHRGHLKSDLVMIKRLFPGQPAEENGAMAVGDLILAVNG
RSTEGLDFQEVLHLLRGASQEVTLLLCRPPPGALPEMDQGWQTPVLAADKEFSRAACTDL
EQSPSLDQGDSRRDSASPDTGEGLGLRPESFQQATQEAQWDQDTERPWATSLTDPRDSFP
HLCRLHQEMEASTLATSLEKDLRQNCDSVCDIRRLGRFSYSSSLTRLSTDIF
Download sequence
Identical sequences F1N2X3
ENSBTAP00000007319 ENSBTAP00000007319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]