SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007809 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007809
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily POZ domain 9.64e-28
Family BTB/POZ domain 0.00086
Further Details:      
 
Domain Number 2 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007809   Gene: ENSBTAG00000005951   Transcript: ENSBTAT00000007809
Sequence length 612
Comment pep:known chromosome:UMD3.1:17:74183420:74186418:1 gene:ENSBTAG00000005951 transcript:ENSBTAT00000007809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSGPLALRWCVWAGRGDMGPDMELPSHSKQLLLQLNQQRTQGFLCDVIVMVENAVFRAH
KNVLAASSVYFKSLVLHDNLISLDTDMVSSAVFQQILDFIYTGRLLPGEPPAEPNFSTLL
TAASYLQLPELAALCRRKLKRAGKPFGSGRGGAGLGRHPRSQRLSTASVIQTRYPGLVDG
RKGAHAPQELSQAKGSDDELFLGGLSQEGAHGLGRPVCPGSGEAGLGGCSTNGAGGSCEQ
ELGLDLSKKSPPLPPATPGPSLTPDDPAQLSDSQEGSPLSTSAPPVANSASYTELGGALS
EPMDLEGADDNPLCLLEGPGGPPPRKSLRHSARKKEWAKKEPAAASPFERRDVAPKGPCP
GEEAEGLGDRVPNGLLAGSAAAGRPFGEPPHACKEEDENGKDGSDDSAQSGSEGGPAGAP
YVYRQEGFEPVPYGDNLYVCIPCAKGFPSSEQLNAHVETHAEEELLLKEEGGAYETGSAG
ADEEAEDLSAPSAALAAGPRPFKCSACEKTYKDAATLRQHEKTHWLARPFPCGICGKMFT
QRGTMTRHMRSHLGLKPFACGECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRN
LISHLRMHTAPS
Download sequence
Identical sequences E1BDC0
ENSBTAP00000007809 NP_001179199.1.59421 NP_001179199.1.76553 XP_019833653.1.53367 ENSBTAP00000007809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]