SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010311 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010311
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.16e-108
Family Inorganic pyrophosphatase 0.0000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010311   Gene: ENSBTAG00000007836   Transcript: ENSBTAT00000010311
Sequence length 289
Comment pep:known chromosome:UMD3.1:28:26576202:26614511:-1 gene:ENSBTAG00000007836 transcript:ENSBTAT00000010311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKEVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVEDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKNFAIDIIESTHDYWRALVTKKTDGKGI
SCMNTTVSESPFQCDPDAAKAIVDALPPPCESACTIPTDVDKWFHHQKN
Download sequence
Identical sequences P37980
NP_001068586.1.59421 NP_001068586.1.76553 XP_005904293.1.15283 XP_006078135.1.26621 XP_010850525.1.44457 XP_019809727.1.53367 XP_020733075.1.74333 ENSBTAP00000010311 ENSBTAP00000010311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]