SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010530 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010530
Domain Number 1 Region: 637-783
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.4e-46
Family Toll/Interleukin receptor TIR domain 0.0000000662
Further Details:      
 
Domain Number 2 Region: 54-190,404-546
Classification Level Classification E-value
Superfamily L domain-like 1.36e-31
Family Leucine rich effector protein YopM 0.049
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010530
Domain Number - Region: 595-647
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.00187
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.061
Further Details:      
 
Domain Number - Region: 343-402
Classification Level Classification E-value
Superfamily L domain-like 0.00408
Family Leucine rich effector protein YopM 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010530   Gene: ENSBTAG00000008008   Transcript: ENSBTAT00000010530
Sequence length 784
Comment pep:known chromosome:UMD3.1:17:3949710:3963032:-1 gene:ENSBTAG00000008008 transcript:ENSBTAT00000010530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRALWTAWVWAVIILSTEGASDQASSLSCDPTGVCDGHSRSLNSIPSGLTAGVKSLDLS
NNEITYVGNRDLQRCVNLKTLRLGANEIHTVEEDSFFHLRNLEYLDLSYNRLSNLSSSWF
RSLYVLKFLNLLGNLYKTLGETSLFSHLPNLRTLKVGNSNSFTEIHEKDFTGLTFLEELE
ISAQNLQIYVPKSLKSIQNISHLILHLKQPILLVDILVDIVSSLDCFELRDTNLHTFHFS
EASISEMSTSVKKLIFRNVQFTDESFVEVVKLFNYVSGILEVEFDDCTHDGIGDFRALSL
DRIRHLGNVETLTIRKLHIPQFFLFHDLSSIYPLTGRVKRVTIENSKVFLVPCLLSQHLK
SLEYLDLSENLMSEETLKNSACKDAWPFLQTLVLRQNRLKSLEKTGELLLTLENLNNLDI
SKNNFLSMPETCQWPGKMKQLNLSSTRIHSLTQCLPQTLEILDVSNNNLDSFSLILPQLK
ELYISRNKLKTLPDASFLPVLSVMRISRNIINTFSKEQLDSFQQLKTLEAGGNNFICSCD
FLSFTQGQQALGRVLVDWPDDYRCDSPSHVRGQRVQDARLSLSECHRAAVVSAACCALFL
LLLLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLMV
QELEHFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPVDETQQEGFWLNLRA
AIRS
Download sequence
Identical sequences F1N720
ENSBTAP00000010530 XP_005217503.1.76553 XP_005217504.1.76553 XP_015330815.1.76553 XP_015330816.1.76553 9913.ENSBTAP00000010530 ENSBTAP00000010530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]