SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010619 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010619
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 1.1e-34
Family Sedlin (SEDL) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010619
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000844
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010619   Gene: ENSBTAG00000008075   Transcript: ENSBTAT00000010619
Sequence length 219
Comment pep:known chromosome:UMD3.1:15:30117755:30121430:1 gene:ENSBTAG00000008075 transcript:ENSBTAT00000010619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGVDVNGKYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Download sequence
Identical sequences A0A212DHN7 D2I333 F7BPJ2 L8IFV0 M3VW28 M3Y0U2 Q2TBL9 S9YVG4 W5PSI4
ENSMPUP00000004943 9685.ENSFCAP00000001067 9796.ENSECAP00000004298 9823.ENSSSCP00000016027 9913.ENSBTAP00000010619 9913.ENSBTAP00000044469 ENSECAP00000004298 ENSAMEP00000000049 ENSFCAP00000001067 ENSVPAP00000000246 ENSFCAP00000001067 ENSSSCP00000016027 ENSOARP00000013413 ENSMPUP00000004943 ENSVPAP00000000246 ENSBTAP00000010619 ENSECAP00000004298 ENSAMEP00000000049 NP_001178133.1.59421 NP_001178133.1.76553 XP_001503119.1.31192 XP_002929644.1.58354 XP_003992476.1.62641 XP_004016136.1.66739 XP_004412666.1.74151 XP_004667440.1.11716 XP_004750038.1.14098 XP_005689583.1.57651 XP_005897193.1.15283 XP_005955157.1.78601 XP_006078724.1.26621 XP_006175368.1.101512 XP_006207808.1.17985 XP_006749251.1.47382 XP_007072969.1.5354 XP_010951742.1.22495 XP_010979661.1.51371 XP_011973175.1.54773 XP_014711145.1.49734 XP_014937545.1.86478 XP_017505742.1.32401 XP_019324493.1.44245 XP_019830744.1.53367 XP_020727685.1.74333 XP_021552028.1.83697 ENSBTAP00000010619 ENSSSCP00000016027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]