SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010796 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010796
Domain Number 1 Region: 1316-1391,1437-1497
Classification Level Classification E-value
Superfamily EF-hand 3.64e-24
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 734-809,851-910
Classification Level Classification E-value
Superfamily EF-hand 8.33e-24
Family Calmodulin-like 0.022
Further Details:      
 
Domain Number 3 Region: 73-135,172-237
Classification Level Classification E-value
Superfamily EF-hand 8.15e-21
Family Calmodulin-like 0.0092
Further Details:      
 
Domain Number 4 Region: 1074-1140,1182-1242
Classification Level Classification E-value
Superfamily EF-hand 1.26e-18
Family EF-hand modules in multidomain proteins 0.00043
Further Details:      
 
Domain Number 5 Region: 406-466,502-569
Classification Level Classification E-value
Superfamily EF-hand 2.1e-18
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 6 Region: 926-934,966-1035
Classification Level Classification E-value
Superfamily EF-hand 0.000000116
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 7 Region: 617-693
Classification Level Classification E-value
Superfamily EF-hand 0.000000174
Family Calmodulin-like 0.073
Further Details:      
 
Domain Number 8 Region: 283-361
Classification Level Classification E-value
Superfamily EF-hand 0.0000052
Family Calmodulin-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010796   Gene: ENSBTAG00000030189   Transcript: ENSBTAT00000010796
Sequence length 1499
Comment pep:known chromosome:UMD3.1:5:115352804:115419183:1 gene:ENSBTAG00000030189 transcript:ENSBTAT00000010796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKMAVVPDWHIICPYTRKFTHSRPHSSPCRVYSRSVFQNMFRPSSSTTVANPILSSLDV
KRILFQKITEKGDELKRAFHLLDTANNMTVTKSELRRVITTFLLPLTREQFQDVLAQIPL
TSSGAVPYLVFLSRFGGIDLNINVIKRGGENEMNGCRTLKDLEAQVGEKIFKNIKTVIKA
LMLIDVNTTGLVQPHELRRVLETFCLKMKDEEYKKFAQHYNIDKDAAVDYNVFLKNLGSN
NDLNLKYNMGSQEVLWENQRVKSFKREEPPSSAVSDNIWKNYSLDEIETAFCLELSKCYE
KVEKALSAGDPCTSGYVSLNYLKIVLDTFVYRLPRRIFIQLMKRFGLKTTTKVNWKQFLT
SFYEPQYEASSKAPLTKRNSINFRNQVHKENVITKLFRHEDHDSSLKKALLLIKSKPDGQ
ITGQELQRILNCMVVKISDSEFRELMRILDPGCTGCVNVSRFIELIEESPKLHKIPAYKD
TKMPLFLAWDSVEEIIHDSIAKNLSAFCNMLRSYDLGDTGLIGRNNFKKIMRVFCPFLTT
EHLVKLCSKFQDIASGRILYKKLLACLGINRPPTVSPVSMPKGQLLNEHLQKEEQPLPDH
SERATPAESQGAVTRNMTKDEVIEKLKSCIQQQDPAFRKRFLDFTKEPNGKIHTHDFKKV
LEDYGMPMDDDQYALLTTKLGYKKEGMSYLDFAAGFEDPKMNEPEVTPPQTPVLPKGDVD
SFFVTAEECLRQFPRRLKEFFRDPYAAFFKMDTDRDGILTMHDLHRLLQHLLFNLKDEEF
ERLLGLLGLRLSITLNFREFRNLCEKRSFSADDDAPQRLPRPKQKVADSELACEQAHQYL
VTKAKTRWSDLSKNFIETDSEGNGILRRRDMKNALYGFDIPLTPREFEKLWMRYDSEGRG
HITYQEFLQKLGINYSADIHRPYAEEYFNFMGHFTKPQQVQEELKELQQSTEKAMPARDK
LKDHDQDISKALAKLDKSRTGYISLGRLQRLLQECGCSLKEEELIDLLNRTSWGIAWHNN
SINYLDFLRAVENNKLTRPQSQEKEESVPINFAALSPEEVLKNIQGVIAASSLALSTAFS
ALDKEDTGFVKASDFGQVLKDFCYKLTDNQYHYFLRKLRLHLTPYINWKYFLQNFSSYVE
ETAVEWAEKMPRGPRPLSPKEMANQELLARLHKAVTSHYHAIAQEFENFDTMKTNTASRD
EFRSICTRHVQVLTDEQFDRLWEEMPVNSKGRLRYLDFLSSFNVDKQATPLATSDSAKAQ
RGSSVPEVSDRGRSAGSSPTRDPKAGSKPRSHPCTPSSVSGTPPLQNCEPIETKLRKKVQ
GCWRELLRECKERDFNKQGEIPGPEFLALVEKFNLDISRDECQQLLIKYDLKNNGKFAYC
SFIQSCVLLLKAKETSLMQRMKIQNANKMKEAGAETCSFYSALLRIQPKIVHCWRPMRRT
FKAYDEGGTGLLSVADFRKVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ
Download sequence
Identical sequences G3MWG7
ENSBTAP00000053738 ENSBTAP00000010796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]