SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010858 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010858
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily EF-hand 9.91e-54
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 142-238
Classification Level Classification E-value
Superfamily EF-hand 6.8e-41
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 218-306
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-22
Family ZZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010858   Gene: ENSBTAG00000008248   Transcript: ENSBTAT00000010858
Sequence length 604
Comment pep:known chromosome:UMD3.1:X:117442266:117604200:1 gene:ENSBTAG00000008248 transcript:ENSBTAT00000010858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHDDTHSRIEHYA
SRLAEMENSSGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE
ERGELERILADLEEENRNLQAEYDRLKEQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAE
AKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRS
DSSQPMLLRVVGSQTSESMGEEDLLSPPQDSSTGLEEVMEQLNNSFPSSRGRNTPGKPMR
EDTM
Download sequence
Identical sequences A8WFL6
ENSBTAP00000010858 ENSBTAP00000010858 NP_001103554.1.59421 NP_001103554.1.76553 XP_005899803.1.15283 XP_005982624.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]