SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013123 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013123
Domain Number 1 Region: 172-500
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.14e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000121
Further Details:      
 
Domain Number 2 Region: 26-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-33
Family Anticodon-binding domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013123   Gene: ENSBTAG00000009949   Transcript: ENSBTAT00000013123
Sequence length 501
Comment pep:known chromosome:UMD3.1:2:61722452:61787886:1 gene:ENSBTAG00000009949 transcript:ENSBTAT00000013123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSANASRRSQEKPREIMDAAEDYAKERYGVSSMIQSQEKPDRVLVRISDLTVQKAGEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISSAEPRLPLQLDDAVRPEVEGEEDGRATVNQDTRL
DNRVIDLRTSTSQAIFRLQSGICHLFRETLTNKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVVEEIADTLVQIFKGLQKRFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGI
EMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
Download sequence
Identical sequences F1MTX7
9913.ENSBTAP00000013123 ENSBTAP00000013123 ENSBTAP00000013123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]