SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017362 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017362
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.00000553
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017362   Gene: ENSBTAG00000013063   Transcript: ENSBTAT00000017362
Sequence length 200
Comment pep:known chromosome:UMD3.1:11:87994386:88010369:1 gene:ENSBTAG00000013063 transcript:ENSBTAT00000017362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGSGKSLLALKTTDANNQEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP
Download sequence
Identical sequences Q3ZBM4
ENSBTAP00000017362 NP_001029620.1.59421 NP_001029620.1.76553 XP_005213023.1.76553 XP_005213024.1.76553 XP_005213025.1.76553 ENSBTAP00000017362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]