SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018232 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018232
Domain Number 1 Region: 37-282
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000387
Further Details:      
 
Domain Number 2 Region: 283-479
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.44e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00013
Further Details:      
 
Domain Number 3 Region: 618-796
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-30
Family AlaX-like 0.018
Further Details:      
 
Domain Number 4 Region: 543-618
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000706
Family AlaX-M N-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018232   Gene: ENSBTAG00000013722   Transcript: ENSBTAT00000018232
Sequence length 983
Comment pep:known chromosome:UMD3.1:23:17609853:17676803:-1 gene:ENSBTAG00000013722 transcript:ENSBTAT00000018232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAGRLRRAIRRSPSWRGLRALSSEAPPIQAAAVRDAFLSFFRDRHGHRLVPSA
SVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHSDLEDVG
RDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFGGDPKAGLGP
DLESRDIWLSLGVPASRVLSFGPEENFWEMGDTGPCGPCTEIHYDLAGGAGAPQLVELWN
LVFMQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGRLSTYDTDLFSPLLDAIHQGCGA
PPYSGRIGAADEGRTDTAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRFST
EVLRAPPGFLGSLVPVVVETLGDAYPELRRSSAQIASLVSEDEAAFLASLQRGRRVIERT
LKRLGPSDVFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVPLDTAGLERLAQEEAQHRAL
QAEPVQEQGLRLNVHALGELQRRGVPPTDDSPKYSYSLQPGGSYKFGTCEAQVLQLYTED
GTAVASIGDGQHCGLLLDKTNFYAEQGGQASDRGYLVLVGQQDVLFPVARAQVCGGFILH
EVVAPERLRVGDQVQLHVDEAWRLSCMEKHTAIHLLNWALRQVLGPGTEQRGSHLNPERL
RFDVATQAPLTPEQLRAVEVTVQKAVGRDEAVYMEEVALARTAHVPGLRSLDEVYPDPVR
VVSVGVPVAHALDPASQAALHTSVELCCGTHLLRTGAIGDLVIIGERQLVKGITRLLAVN
GEQAQQAREVGQRLAQEVEAAAARLSQGSRHVAEAHRLSKDMGRLTDAVDTATMPQWQRR
ELQATLKALQRRANTAVRKLEMGQGARKTKDSLGRHTHSDLMVPSTITENLNIEAEVTRX
LCTQAPGTSVLLLSPQPLGKVLCACQVAQSATPAFTAEAWALAVCSHMGGKAWGSRVVAQ
GTGSTADLEAALSAARAYALNQL
Download sequence
Identical sequences F1MKA6
ENSBTAP00000018232 ENSBTAP00000018232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]