SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018453 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018453
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.28e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 9.57e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018453   Gene: ENSBTAG00000013895   Transcript: ENSBTAT00000018453
Sequence length 551
Comment pep:known chromosome:UMD3.1:29:44496359:44505000:-1 gene:ENSBTAG00000013895 transcript:ENSBTAT00000018453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF
EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMASTLAQALAPGLAQAV
TPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADV
DFSALLSQISS
Download sequence
Identical sequences A1XG22
ENSBTAP00000018453 NP_001073711.1.59421 NP_001073711.1.76553 XP_019810403.1.53367 ENSBTAP00000018453 9913.ENSBTAP00000018453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]