SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019758 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019758
Domain Number 1 Region: 153-301
Classification Level Classification E-value
Superfamily EF-hand 6.92e-53
Family Osteonectin 0.0000000743
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019758   Gene: ENSBTAG00000014835   Transcript: ENSBTAT00000019758
Sequence length 303
Comment pep:known chromosome:UMD3.1:7:64878194:64900828:-1 gene:ENSBTAG00000014835 transcript:ENSBTAT00000019758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVAEVPVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKEKDIDKD
LVI
Download sequence
Identical sequences L8IEM4 P13213
XP_010848901.1.44457 XP_019820836.1.53367 ENSBTAP00000019758 9913.ENSBTAP00000019758 ENSBTAP00000019758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]