SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019990 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019990
Domain Number 1 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000959
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 177-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000126
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 307-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000183
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000019990
Domain Number - Region: 126-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0507
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019990   Gene: ENSBTAG00000015015   Transcript: ENSBTAT00000019990
Sequence length 516
Comment pep:known chromosome:UMD3.1:15:30228672:30237437:1 gene:ENSBTAG00000015015 transcript:ENSBTAT00000019990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPGKVPRKENLGLQCEWGSCSFVCSAMEEFCEHVTQHLQQHLQGSGEEEEEEEDLLEE
EFSCLWRECGFCSPDNSADLIRHVYFHCYHTKLKQWGLQALQSQADLSPCILDFQSRNLI
PDIPDHFLCLWEHCENSFDNPEWFYRHVEAHSLCCEYQVVGKDNNVVLCGWKGCTCTFKD
RFKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQSSLDQQHFQCSHCSKRFATER
LLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEARPFKCDCCDYSCKNLIDLRKH
LDTHSKEPAYSCDFENCTFSARSLYSIKSHYRKVHEGDSEPRYRCHVCDKCFTRGNNLTV
HLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGASLNES
SLQDIILETVPGEPGPQEEAEEEGGGGEGIALPASQGTSSPIIHVVNQTNAQGEREVVYY
VLFEAPGEPPPASEPPSGGVMGELQGAAEEPEVQMV
Download sequence
Identical sequences F1MZ17 L8IIN5
ENSBTAP00000019990 XP_005897184.1.15283 XP_010828755.1.44457 XP_019831172.1.53367 ENSBTAP00000019990 9913.ENSBTAP00000019990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]