SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020447 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020447
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000483
Further Details:      
 
Domain Number 2 Region: 181-305
Classification Level Classification E-value
Superfamily E set domains 1.12e-44
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020447   Gene: ENSBTAG00000015386   Transcript: ENSBTAT00000020447
Sequence length 589
Comment pep:known chromosome:UMD3.1:11:43500946:43527753:1 gene:ENSBTAG00000015386 transcript:ENSBTAT00000020447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGFNPCIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQILNYYGKGKVR
ITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKDAVISR
VRAGINPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPN
TAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGVFSQADVHRQVAI
VFKTPPYCKAIIEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFHK
LWQDCGVNFPERPRPSPLGPTGEGRFIKKEPNLFSHGAVLPETSRPVSSQAESYYSSSAS
ISSTLSHPASAMLPMGTQSSSGWSSVAHPTSRSVNTNSLSSFSTGTLSSNSQVIPPFLEM
SDLNVSNACIYNNTNDIGRMEASSVSPADLYSISDASMLPNCPVNMITPSNDSMRETDNP
RLVSMNLENPSCNSVLDPRDLRQLHQMSPSSMSTVTSSSTTAYVAQSEAFEGSDFNCADN
SMINEAGPSNSTNANSHGFGPNSQYSGIGAMQNEQLSDSFAFEFFKVNL
Download sequence
Identical sequences F1MJH6
ENSBTAP00000020447 ENSBTAP00000020447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]