SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021074 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021074
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000633
Family Calbindin D9K 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021074   Gene: ENSBTAG00000015854   Transcript: ENSBTAT00000021074
Sequence length 872
Comment pep:known chromosome:UMD3.1:3:18686495:18690937:1 gene:ENSBTAG00000015854 transcript:ENSBTAT00000021074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLLRDILCVIETFHKYAREDAATLTCTELKQLIQSEFEDIFQPCAIHAVERNLNLLNI
DSNGAISFDEFVLAIFSFLNVCYLDTQSLLNSEPRQVSKPEGMPHDMGLQVTNETDQWTE
GTSQTQDKVVLPSGTASSTHLSLEERAVEHNRVDPQGHTTAHKLPVETSEHSDSKNQHLK
GDEQSQKVDQDVSATGDSRTQRETSKPMAGSEQISSHTKGEGQNKEILQKGDILARKQSG
TETGGRFGEQEGSLGILHSPLEETTQRPGGSSEDQEVAGEKGVKGHPKSQEPSVQGKDEP
SSEHVDLPKQAAARKPSQTQKSAAAKDESRTAETPEPPIQEKEYETRDLSVQGENRNVSE
TPMVRVERKGVRGPEVHQTVGQKQIEEKTQPPALEEPTEDKKYHELQESSKEKNAGEDSE
THELNSEGGEQKDSESEGAISPGEEARHAEEGTAEALVNSKNAPEAEGTPGTRERIWELT
TLENQSGEKNKMTTKIHDKLVKEDDGYQGEGSEPVATQNDERSPETPNSLTAEDGDSNSE
TSDLFVQGDSQSQTNPFRGSVQGSDSNNPETQKHLALSEEKRVQEAAVLAVRGEDEQVTE
EHAQEHEGQGSATTGRGPAVEPRGHSDTQVFIVRDENTKSLEPGIPGAPNAGITKQLSVR
QLPTKKDSRKELKDQSPSTKKEEDGALEAQEDLVKSLDENNAVSQKTCPATLEEETESPQ
QLAGEQSLSTKEHDPSVSESGLEERMQRDQELCLVERGAEHSSPLYEALQEKMLQQTNVT
QGKHQNQAQTASVASPEIRRNQSSASLTNDSSDGLVFFIDRQALQKYIREFLPDEDPTGA
QQISAPQALEDKQGRPQREELEPQKEASTPKQ
Download sequence
Identical sequences F1MAV8
ENSBTAP00000021074 XP_010801327.1.76553 ENSBTAP00000021074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]