SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021360 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021360
Domain Number 1 Region: 635-809
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-36
Family Phosphotyrosine-binding domain (PTB) 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021360
Domain Number - Region: 603-642
Classification Level Classification E-value
Superfamily SH3-domain 0.00637
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021360   Gene: ENSBTAG00000030179   Transcript: ENSBTAT00000021360
Sequence length 821
Comment pep:known chromosome:UMD3.1:5:120127056:120137203:1 gene:ENSBTAG00000030179 transcript:ENSBTAT00000021360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
ALGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEEEEEDEEEEDEEEGEGEGKEGGGPGSE
TPAPEPLIPSPSLEEPHKHRPTTLHLTTLGAQDSLNNNGGFAPGPLASRQETALCPAVQE
PVREPPAPLPPTDTGPCGAQPPVRPGCDSEGNQPAGPVAPGGASPSSDPGIEADLGSGSS
GGRGGRRSSQDLSSPGSDYEDVGGARLGRMISSISETELERSSDDGSSSSGRSSHLTNSI
EEASSPASEPEPEPEPPREPPRRPAFLPVGPEDTNSEYESGSESEPDLSEDADSPWLLSN
LVSRMISEGSSPIRCPGQCLSPSPRSAGEPASPAGEALAAAAPGSVELVDMETLCGPPPP
APPAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRPARPGRACSAACSDEDDDEDEEEED
EAEAKAAPPGGRGAGPAALDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGEDSEDSGG
EASEEEAGAVLLGGDQGPGDASPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNG
EEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHA
VPGPAKDLLGSKRGPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPP
ASCDLEISLRGVKLSLSGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFA
CHVFVSQESMRPVAQSVGRAFLEYYQQHLEYACPTEDIYLE
Download sequence
Identical sequences G3X783
ENSBTAP00000021360 ENSBTAP00000021360 NP_001180128.1.59421 NP_001180128.1.76553 9913.ENSBTAP00000021360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]