SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021730 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021730
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.01e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021730   Gene: ENSBTAG00000016335   Transcript: ENSBTAT00000021730
Sequence length 176
Comment pep:known chromosome:UMD3.1:26:22385932:22388123:-1 gene:ENSBTAG00000016335 transcript:ENSBTAT00000021730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGAAAALTFLDQESRVRAGGVGSLQVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDLSEEESEEDGSEEEEAELCPVLPAKKLGRRL
Download sequence
Identical sequences F1N420 L8J182
ENSBTAP00000021730 NP_001192489.1.59421 NP_001192489.1.76553 XP_005888149.1.15283 XP_019808764.1.53367 ENSBTAP00000021730 9913.ENSBTAP00000021730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]