SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022184 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022184
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-38
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-17
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000706
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000562
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000635
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022184   Gene: ENSBTAG00000016684   Transcript: ENSBTAT00000022184
Sequence length 648
Comment pep:known chromosome:UMD3.1:15:34848617:34853735:-1 gene:ENSBTAG00000016684 transcript:ENSBTAT00000022184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFPCRPESVSQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCRQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVPPGAEPGSPSELQDPAQTLTPEELREETTQ
SPDLGASEEQTLCQESELQPLQESEVPVLQNPALPEERNSGNSEMVALLTALSQGLVAFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEDDCGIVVSLSFPIPRLDEISHVREEEPLVPDV
PEPQEPEEPEILSFTYTGDGSDDEEECPGQEDLSLEDPHRSVSGDTEIHQTPDWEIVFED
DPGRLNERRLGTKMSQVSSSTNLQETMPVHLLLGRHHNCPVCGKSFTCNSHLIRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKVHRTNAPHKYPLNRRSLGEAAPLVQAERTPPVEKP
YRCEDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCG
ECGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFSHSAAFAKHLRGHASVRPCRCSECGK
SFSRRDHLIRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSQKAS
Download sequence
Identical sequences E1BM18
XP_001788064.2.59421 XP_002693136.1.76553 ENSBTAP00000022184 ENSBTAP00000022184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]