SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022387 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022387
Domain Number 1 Region: 32-149
Classification Level Classification E-value
Superfamily POZ domain 3.98e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000846
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022387   Gene: ENSBTAG00000016829   Transcript: ENSBTAT00000022387
Sequence length 634
Comment pep:known chromosome:UMD3.1:23:7426487:7428391:-1 gene:ENSBTAG00000016829 transcript:ENSBTAT00000022387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSPLSPSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVS
IRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMA
AADIVNFLTVGSVLQMWHIVDKCTELLREGRASASATTVTTAAATSVTVPGAGVPSGSGG
TVAPATVSSVRSHASSRASENQSPSSSNYFSPRESTDFSSSSQEAFAASAVGSGERRTGG
PVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIVPQKHWVY
VKRGGNCPASAPLAPQDPDLEEEEEEEDLVLTCEDDEDEELGGGSGVPARGGPEATLSIS
DVRTLSEPPDKGEEQVNFCESSNDFGPYEGGGPGAGLDDSGGPTPSSYAPAHPPRPLLPL
DMQGNQILIFPSSSSSSSSSQPPGNQAEHGAVTLGGTLAGALGGPGGTGGTPGGTGSGDG
NKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYE
CSVCAKKFMWRDSFMRHRGHCERRHHLGGGGGGGPGPGGGPSGPALQPKRESPCGGGGSG
DEASGATPPSSRCVWSPLSVHKVEMGFSGGGGAN
Download sequence
Identical sequences F1MLP0
ENSBTAP00000022387 ENSBTAP00000022387 XP_005196602.1.59421 XP_005223345.1.76553 XP_019840788.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]