SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023310 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023310
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily L domain-like 6.8e-61
Family Leucine rich effector protein YopM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023310   Gene: ENSBTAG00000017533   Transcript: ENSBTAT00000023310
Sequence length 432
Comment pep:known chromosome:UMD3.1:23:6530409:6580289:-1 gene:ENSBTAG00000017533 transcript:ENSBTAT00000023310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIPEIPESISFCKALQIADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYN
LASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSEL
PQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLEMLPDGIGKLKKLSILK
VDQNRLTQLPEAVGDCESLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIG
GCCSLTVFCVRDNRLTRIPAEVSRAAELHVLDVAGNRLSHLPLSLTALNLKALWLSDNQA
QPLLTFQTDTDHTTGEKILTCVLLPQLPSEPACQENLPRCGALESLVHDVSEEAWNERAV
NRVSAIRFLDDEKDDDDNETRTLLRRATPHPGELKSMKKTVENLRNDRNAAKGLDSNKNE
VNHAVDRVTTSV
Download sequence
Identical sequences F1MZ10
9913.ENSBTAP00000023310 ENSBTAP00000023310 ENSBTAP00000023310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]