SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025989 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025989
Domain Number 1 Region: 15-154
Classification Level Classification E-value
Superfamily Nudix 2.57e-33
Family MutT-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025989   Gene: ENSBTAG00000019509   Transcript: ENSBTAT00000025989
Sequence length 172
Comment pep:known chromosome:UMD3.1:13:12246303:12266216:1 gene:ENSBTAG00000019509 transcript:ENSBTAT00000025989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQETAGSSRNTEQSIISEELIAEGKWVKLEKTTYRDPTGKTRTWETVKRTTRKGQSADG
VAIIPVLQRTLHYECIILVKQFRPPMGGYCLEFPAGLIDDNESPEAAALRELEEETGYKG
DVAECSPAVCMDPGLSNCTAHIVTVTINGDDAENVRPKPKPGDGGTSSHPGG
Download sequence
Identical sequences F1MMR8
ENSBTAP00000025989 ENSBTAP00000025989 9913.ENSBTAP00000025989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]