SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026038 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026038
Domain Number 1 Region: 133-308
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.06e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.0000654
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026038   Gene: ENSBTAG00000019542   Transcript: ENSBTAT00000026038
Sequence length 335
Comment pep:known chromosome:UMD3.1:1:10201965:10217710:1 gene:ENSBTAG00000019542 transcript:ENSBTAT00000026038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVVRGMRLWRAAPSGGAAWRSVVTSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTE
KIEVKHVGKTDPGTIFVLNKNVSTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSC
EIKFLTFKDDDPGEVNKAYWRSCAMIMGCVIERAFKEEYVVHLVRAPEVPVIAGAFCYDV
VLDKRLDEWMPTKENLRSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKVDFIEEK
ASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSVVHNLQATQSSLVRRFQGLSLP
VHLRAHFTIWNKLLERSRKMVTEDQTKPTEKSAST
Download sequence
Identical sequences Q05B74
NP_001074199.1.59421 NP_001074199.1.76553 ENSBTAP00000026038 ENSBTAP00000026038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]