SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026911 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026911
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-38
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 436-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 633-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 6 Region: 515-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000425
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 214-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000536
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 8 Region: 377-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000539
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026911   Gene: ENSBTAG00000018625   Transcript: ENSBTAT00000026911
Sequence length 687
Comment pep:known chromosome:UMD3.1:25:2733865:2740470:1 gene:ENSBTAG00000018625 transcript:ENSBTAT00000026911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMASGPGFQDREGLLIVKLEEDSAWSQELPQPDPGPSPEASHLRFRRFRFQEAAGPREA
LSRLQELCHGWLQPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVED
MQKELGRLRQKVTNRGRGTEMLLEEPLPLETAQESPSFKLEPMETERSPGRRLQELLGPG
PKRDPQTVKERALSAPWLSLFPPEGNMEDKELTGPQLPESLEDVAMYISQEEWGRQHPSK
RALSRDTVQESYENVDSLESQVPSQEALSTQVEHGGKPWHPSVQTCKEGLSSRTPAPGEE
KFENQEECAQSASPESIHCQALLPGQARGEVPWSPEQGRPRDRAEKLWEPPTEDRMEQSL
VGATSCKKLGRPTELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECAEIFGG
NPHFLSLHRAHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNL
HRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHE
RTHEKERLYPFSECGEAVRDSTLFLTNPGTHPKAEKKLFQCLTCGKSFRQGMHLTRHQRT
HTGEKPYKCNLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGE
KPYKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F1N176
ENSBTAP00000026911 ENSBTAP00000026911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]