SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028370 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028370
Domain Number 1 Region: 268-358
Classification Level Classification E-value
Superfamily Fibronectin type III 6.91e-16
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 137-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000104
Family Ankyrin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028370   Gene: ENSBTAG00000021292   Transcript: ENSBTAT00000028370
Sequence length 763
Comment pep:known chromosome:UMD3.1:19:7329920:7490693:1 gene:ENSBTAG00000021292 transcript:ENSBTAT00000028370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERNPERNFPFQEKDCSCATRIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPATCSSAA
SNNLNWNCRVKMTQQMQNLHLSQSKKHSTPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFR
TRTDRLSLRKTSVNFQGNEAMFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDI
AIMTNNVPIARILLKTGARESPHFVSLESRSIHLNTLVQEAQERVSELSAQVENEGFSLD
NTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEAPTSACLMVTSSTSLTVSFQEPLSVNAA
VVTRYKVEWSMSKDFCPLAGEIIMENLQILKYTITGLTTGQQYFVQVSAYNMKGWGPAQT
TTPACASPSNWKDYDDRAPRHKGQSEVLEGLLQQVRALHQHYSCRESSKLQTSGRKQSVS
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDSHTSSITQDFLW
FTKLSCMWEDIRWLRQSVPISMSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKD
RHGNILIVTIREVEMLYSFFSGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYH
KRSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENYNISKEEWEWVQKLS
GSESMESVDHTSDCPMQLFFYELQMAVKALLKQINIPLYQARNFRLYTQEVLEMGHNVSF
LLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences F1MYK8
ENSBTAP00000028370 ENSBTAP00000028370 9913.ENSBTAP00000028370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]