SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028809 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028809
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028809   Gene: ENSBTAG00000021620   Transcript: ENSBTAT00000028809
Sequence length 211
Comment pep:known chromosome:UMD3.1:2:129716209:129723902:1 gene:ENSBTAG00000021620 transcript:ENSBTAT00000028809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCHCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTD
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHKVHQVTPQTHFIS
Download sequence
Identical sequences A5PK88
ENSBTAP00000028809 ENSBTAP00000028809 9913.ENSBTAP00000028809 NP_001092360.1.59421 NP_001092360.1.76553 XP_006078006.1.26621 XP_019837072.1.53367 XP_020730205.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]