SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029139 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029139
Domain Number 1 Region: 1126-1323
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000259
Further Details:      
 
Domain Number 2 Region: 911-1034
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 19-141
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029139   Gene: ENSBTAG00000021857   Transcript: ENSBTAT00000029139
Sequence length 1941
Comment pep:known chromosome:UMD3.1:13:25734381:25811083:-1 gene:ENSBTAG00000021857 transcript:ENSBTAT00000029139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKSKDGKEQSETVSPSEDEMFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSFK
DEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVI
ALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDAYLKGNEAYSGNARNIPEPPP
VCYPWPSSAPPAMAQPPEPPPPDSTASKPQTSPPVLTQPGRAYRMEIQVPPSPPEVAKSN
TAVCVCNESVRTVIVPSEKVVDLLPNRSNHTVPAHRTEEVRYGRNEQPSFKTATRTTSPP
SSVPTAHLIHQPGSRSLEPSGILLKSGHYGGHSEGLVSRSPAVESPSVTVNHYSPNSHQH
IDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLRAASQSTADYNQVVLNRAALQVRRRSTS
QDRVPQSIQVRQRSVSQERLEDSVLMMYCPRSASQGALTSPSISFSNHRTRSWDYIEGQG
ETSENVHSECPPPDANGERKQTYKWSGFTEQDDRRGIYERPRQQEIHKSFRGSNFTVAPS
VVNSDSRRVSSRIGGSVSQFKKIPADLKPLQPSRNFQTACGISQPRGISQDRSPLGKVRS
NSLKGPSMHVAKPPSSQNSFLSIKDQRPVNHLHQNSLLNQQPWLRTESAPDHQVDTGKPP
SLSGASVKPPALASENASTPDFELSVSQRNQDLNVQEVEIQQSNAVDNKETVILREKPPS
GRQTPQPLRHQSYILAVSDQETGSDTTCWLPNDARREVHIKRMEERKASSTTPPGDSLAS
IPFIDEPTSPSIDHDISHIPASAVISASTSQVPSIATVPPSLTTSAPLIRRQLSHDQESV
GPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKILDSQKSSEDSGSRKD
SSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQTTPS
EEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNE
EDTGVTNRDLISRRIKEYNSLMSKAEPLPKTPRQSLSIRQTLLGAKAEPRTQSPHSPKEE
SERKLLSKEKQSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTN
RYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDNQKWRDL
NVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKF
LSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHD
WFFTEEGAEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGS
WGSGKDQYSKDLLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKENSEQGHHDIKE
ESKKESETPGRKQRTVAPKENNTKKDSSGGGRAEQRAPRGESLEPPAPQSTKQSRSPTLS
CRLAVLRESPRALAAQKTSHLEDTGSDSSTPLSTHAPAPPASFPTKKPPSPEPKHSELLV
SVGSITSDHAGTPSAPYLAGLDSSRLSPEVQSMAESRGFEADDERSELVSEGRPVETDSE
SDFPVFPAAPASDRLFRGKLQEAARTSRRNSEGSEVSCTEGSLTPSLESRRQLFSSHKLI
ECDTLSRKKSARFKSDSGSLGDAKNEKEAPSITKVFDVMKKGKSTGNLLTPPARSESDKQ
EPTWKTKIADRLKLRPKAPADDMFGVGSQKTIAEPAKRKNIKRRHTLGGHRDATEMSVLN
FWKAQEHSGDRESELSAVNRLKPKCSAQDLSISDWLARERLRTSMTDLSRGDTGDPRPES
LGTLEIPTRDPPLSFQSDADSSSSTLASTNRAPLSTPSQSPDQINGESFQNTSQNSSSAA
RVQPHQLSETPDHKAQFHPCL
Download sequence
Identical sequences F1MHG5
ENSBTAP00000029139 ENSBTAP00000029139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]