SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029886 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029886
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily EF-hand 0.000000000049
Family Calmodulin-like 0.079
Further Details:      
 
Domain Number 3 Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000188
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029886   Gene: ENSBTAG00000022155   Transcript: ENSBTAT00000029891
Sequence length 307
Comment pep:known chromosome:UMD3.1:1:65742633:65802423:-1 gene:ENSBTAG00000022155 transcript:ENSBTAT00000029891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWRRWLALALVAVAWVHAEEQVRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPH
KRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDEL
RRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINI
TTYADQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYA
DGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQAEEEMTRYVQELQKHQETAEKSK
RVSTKEI
Download sequence
Identical sequences Q58D84
9913.ENSBTAP00000029886 NP_001017950.1.76553 XP_005200261.1.59421 XP_005905487.1.15283 XP_005971719.1.78601 XP_010843690.1.44457 XP_019843280.1.53367 ENSBTAP00000029886 ENSBTAP00000029886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]