SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030975 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030975
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-36
Family SCAN domain 0.0000753
Further Details:      
 
Domain Number 2 Region: 399-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 440-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 357-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 228-275
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-16
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030975   Gene: ENSBTAG00000047954   Transcript: ENSBTAT00000031011
Sequence length 507
Comment pep:known chromosome:UMD3.1:X:18874919:18886469:1 gene:ENSBTAG00000047954 transcript:ENSBTAT00000031011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVKAPACLYPHVEVLQGTKRSVKESSNKSKKSSPQMGSLHPDSARQHFRRFCYHDTPG
PYEAVSQLQELCSQWLRPEIHSKEQILELLVLEQFLDVLPSHIQNWVQKYHPQNVKEAVA
LVDRFQRECGGISNEVTTHQLGNDTALLGGTAVAPGFKWKPAEPQQMGVFQEECSNIYQV
LQDPDWNTHKESQPVDKGAVPAEESPTFSEEKSTPSWKLASKLTLPKSQSPLTFEDVAFY
FSEEEWKIMTPDEKTLYLDVMQELYEDVASVGLKLKNDTGNDPPVSLPTLEIQPSGCEVL
RKATMKDAETTMGDVNHGGTCRVWKRPRAFPGRKRKKLKTCKQELPKPVDVHGKGCEGEK
PFKCQECGKSFRVSSDLIKHQRVHTEERPYKCEQCDKQFRWSSDLNKHLMAHQGIKPYRC
SWCGKSFSHNTNLHTHLRIHTGEKPFKCYECGKRFIQNSHLIKHQRTHTGEQPYTCSICN
RNFSRRSSLLRHQKLHKRRESCPVSPV
Download sequence
Identical sequences G5E5U2
ENSBTAP00000030975 ENSBTAP00000030975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]