SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031695 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031695
Domain Number 1 Region: 110-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 54-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 158-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000148
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031695   Gene: ENSBTAG00000032806   Transcript: ENSBTAT00000031749
Sequence length 182
Comment pep:known chromosome:UMD3.1:X:58242198:58242746:-1 gene:ENSBTAG00000032806 transcript:ENSBTAT00000031749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSNLIRHQRTHTGEKPFICKECGKTFSGKSNLTEHEKIHIGEKPFKCNECGTAFGQKKY
LIKHQNIHAGEKPYECNECGKAFSQRTSLIVHERIHSGDKPYECNVYGKAFSQSSSLTVH
VRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIH
TH
Download sequence
Identical sequences E1BKU6
ENSBTAP00000031695 ENSBTAP00000031695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]