SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031762 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031762
Domain Number 1 Region: 670-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 325-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 7-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 380-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 219-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.56e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 10 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 542-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000354
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031762   Gene: ENSBTAG00000014593   Transcript: ENSBTAT00000031816
Sequence length 741
Comment pep:known chromosome:UMD3.1:18:58086970:58100603:-1 gene:ENSBTAG00000014593 transcript:ENSBTAT00000031816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILHGTVLLQGSLTLEDVAVDVTWEEWQLLAPAQKALYQDVMLEDYSNLVSVGTGYQVSK
PDVLSKLEKSLSNILSEIEILLSFCTYIKEVDDHVQLHWQNQNMPKCHEQNAFGNIIHQS
RSCFPLRPNYDVFDLHRKTLKSYLDVTNQKKSCNKKEPAEFNWDGRFLLHAHHEQTHTEI
EHQEIHKTENTHKFKLTEHQRTYKGEKPHECFECGRAFLSEHQKMHTGNKPHVCSICGKA
FYRKFKLTEHQRTHTGEKAYKCTECGKAFFRKAELTIHQQNKTGEKPHVCSECGKAFSRK
SQLFLDQKIQTGGKSYICRECGKGFTQKGNLLIHQLTHTGEKPYGCTECGKAFSQKACLI
AHQRFHTGEKPYVCSDRRKAFTTKTMLTVHQRTHTGERLYGCNECGRTFSHIHKAYLIAH
QRLHTGEKPYECRECGRTFFLFKSDLTKHQRIHREEKPCECSDCKKAFRSKAKLIQHQRT
HTRERPYGCSKCGKAFPWKSKLSLHQRTHSGERPFRCGVCDKAFMVKAHLTVHQRTHTGE
KPYKCSDCEKAFSKKTQLLIHQRIHTGERPYGCTEKSHECSECGKILSSKSTLIVHQRTH
TGEKPFKCSACDRAFTSKAHLVIHLRVHTGERPYECSNCEKAFSTKAYLMIHQRIHTGER
PYGCSECPQAFIQKSTLIIHQRTHTGEKPFKCSVCDKAFTAKSYLTVHQRIHTGEKPYEC
PHCKKAFTTLSALISHRRTHT
Download sequence
Identical sequences F1MKQ4
ENSBTAP00000031762 ENSBTAP00000051646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]