SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031988 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031988
Domain Number 1 Region: 77-257
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-54
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031988   Gene: ENSBTAG00000014296   Transcript: ENSBTAT00000032046
Sequence length 260
Comment pep:known chromosome:UMD3.1:18:49184591:49189071:1 gene:ENSBTAG00000014296 transcript:ENSBTAT00000032046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVREGPELGGGMEEPASPQEPASPPPPPSPPSPAAPETPRLPAPESPTEAHARQLLLQ
EWAPPRGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQPLEALGN
FRGWHIRTEKLQQNLSWTVKQQCVDLLAEGLWEELLDDEQPRITVMDWFEDSRLDACVYE
LHVWLLAADRSTVIAQHHVAPRTSGRGPPGHWIQVSHVFRQYGPGVRFVHFLHKTKNRME
RGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences G3N3T9
ENSBTAP00000031988 ENSBTAP00000056600 XP_002695095.1.76553 XP_006068734.1.26621 XP_597250.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]