SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035657 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035657
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.82e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 654-663,785-824
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000366
Family Formin homology 2 domain (FH2 domain) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035657   Gene: ENSBTAG00000019685   Transcript: ENSBTAT00000035789
Sequence length 1128
Comment pep:known chromosome:UMD3.1:23:27463438:27474655:1 gene:ENSBTAG00000019685 transcript:ENSBTAT00000035789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTTMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSTSATHGGGPTPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGAQAQHSQPPPQTPTVAPEPVALTSQTSEPVESEVPPREPMEAEEVEERAPAQ
SPELTPSGPAPAGPASAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAA
TTDYNNNQEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYT
TPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPSAEAPPAGAGQASSVAPSSTAVESSNE
GASPPGPAPPPTTSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHG
QTLGQQVPGFPTAPTRLVIARPTPPQARPSHPGGPPVSGALPGAGLGTNASLAQMVSGLV
GQLLMQPVLVAQGTPGMAPSPAPATASASSGTTNTATTAGPAPGGPAQPPPPQASTSDLQ
FSQLLGNLLGPAGPGTGGPGMASPTITVAMPGVPAFLQGMTDFLQATQTAAPPPPPPPPP
PPPPAPEQQTAPPPGSPSGGSGSPGSVGPESLPLEFFTSVVQGVLSSLLGSLGARAGSSE
SIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQ
LRSFFHQHYLGGQEPTPGNIRTATHALITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQE
QFNSIAAHVMHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSR
GVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQTLPEEPMEVQGSERTS
PEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASTETEPWAAAVPPEWVPIIQQ
DIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPES
LSRDLEAPEVQESYRQQLRADIQKRLQEDPNYSPQRFPNAHRAFADDP
Download sequence
Identical sequences F1MY28
ENSBTAP00000035657 ENSBTAP00000035657 NP_001068834.2.59421 NP_001068834.2.76553 XP_015315358.1.76553 9913.ENSBTAP00000035657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]