SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038013 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038013
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 1351-1445
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 127-233
Classification Level Classification E-value
Superfamily Immunoglobulin 7.64e-20
Family I set domains 0.0086
Further Details:      
 
Domain Number 4 Region: 245-339
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 1621-1706
Classification Level Classification E-value
Superfamily Immunoglobulin 4.66e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 1801-1894
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 7 Region: 1164-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000132
Family I set domains 0.032
Further Details:      
 
Domain Number 8 Region: 798-892
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000777
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 1071-1157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000128
Family I set domains 0.044
Further Details:      
 
Domain Number 10 Region: 980-1075
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000238
Family I set domains 0.056
Further Details:      
 
Domain Number 11 Region: 890-985
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000024
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 720-811
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000776
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 333-428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000139
Family I set domains 0.022
Further Details:      
 
Domain Number 14 Region: 1722-1808
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000204
Family I set domains 0.0041
Further Details:      
 
Domain Number 15 Region: 1450-1535
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000178
Family I set domains 0.025
Further Details:      
 
Domain Number 16 Region: 1259-1343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000266
Family I set domains 0.03
Further Details:      
 
Domain Number 17 Region: 1542-1630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000155
Family I set domains 0.0033
Further Details:      
 
Domain Number 18 Region: 515-604
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000202
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 19 Region: 433-543
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000286
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038013   Gene: ENSBTAG00000040338   Transcript: ENSBTAT00000038198
Sequence length 1901
Comment pep:known chromosome:UMD3.1:2:108216731:108225840:-1 gene:ENSBTAG00000040338 transcript:ENSBTAT00000038198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPTVVWEKGGQQLAASDRLSF
PVDGAEHCLLLSGALPTDAGVYVCRARNSAGEAYAAAAVTVLEPPAHEPEPQLAERPLPP
PGAGEGAPVFLTGPRSQWVLRGAEVVLECQVGGLPAPTLYWEKDGMALDEVWDSSHFSLE
PGRAGAGAGASLALRILAARLPDSGVYVCHARNAHGHARAGALLQVQQTPESPPEDPDEA
PTPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG
GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFSRPLQDVEGREHGIAVL
ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGVYLCEMRGRVRT
VANVTVKGPILKRLPRKLDVFEGENAVLLVETREAGVEGRWSRDGEDLPATCQSSSGHMH
ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCIKHNPPGPPVLAEMFKGHRNTVLLTWKP
PDPTPETPFIYRLERQEVGSEDWVQCFSIEKAGAVEVPGDCVPTEGDYRFRVCTVSEHGR
SPHVVFHGSAHLVPTAHLVAGLEEVQVYDGEDAVFSLDLSTVIQGTWFLNGEELKSNEPE
GQVGPGPLRYRVEQHGLQHRLILQAVRHQDSGALIGFSCPGVQDSAALTIQESPVHILSP
QDKVSLTFTTSDRVVLTCELSRVDFPASWYKDGQQVEESESLVVKMDGRKHRLILPEAQV
QDSGEFECRTEGISAFFSVTVQDPPVHIVAPREHVFVHAITSECVMLTCEVDREDAPVHW
FKDGQEVEESDFVLLESEGPHRRLVLPSAQPSVGGEFQCVAGDERAYFTVTITDVSSWIV
YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV
QLEDSGEYLCEIDDESASFTVTVTEPPVRILYPRDEVTLVAVSLECVVLMCELSREDAPV
RWYKDGLEVEESEALVLESDGPHRRLVLPAAQPQDGGEFVCDAGDDSAFYTVTVTAPPER
IVHPAARSLDLQFRAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL
PHAQPEDAGEYVCETRDEAVTFNISLAEPPVQFLAPEAAPGPLCVAPGEPVVLSCELSRA
GALVFWSHNGKPVQTGEGLELRAEGPRRVLCIRAADLAHAGLYTCQCGAAPGAPSLSFTV
QVAEPPVRVVAPEAAQTRVRSTPGGDLELAVRLSGPGGPVRWYKDGERLASQGRVQLEQD
GARQVLRVRGARSRDAGEYLCDTPQDSRIFLVSVEEPPLVKLISELTPLTVHEGDDATFR
CEVSPPDADITWLRNGVVVTPGPQLEMTQNGSSRTLTVRSCRLEDAGTVTARAGGTSTSA
RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWMRGGAPLPPDSRLSTAQ
DGHIYRLFIHCVVLADQGTYGCESHHDRTLARLSVRPKQLRVLQPLEEVTIIEGGSATFQ
LELSQEGVTGEWARGGVRLQPGPKCQIQAEGHAHHLVLSGLGLADSGCISFTADTLRCAA
RLTVREAPVTIVRGLQDLEVTEGDTATFECALSQTLADVTWEKDGQPLTPSARLRLQALG
TRRLLQLRRCSPLDAGTYSCVVGMARTGPVHLVVRERKVSVLSELRSVSAREGDGATFEC
TVSEVETAGSWELGGRPLRPGGRVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSVAQ
LEVEALPLQMLRRPPREKTVLVCRRAVLEVTVSRPGGQVCWLREGAELCPGDKYQLRSHG
PTHSLVIHDVRPEDQGTYCCQAGQDSAYTRLLVEGDATLST
Download sequence
Identical sequences E1BNH9
ENSBTAP00000053524 NP_001068959.2.59421 NP_001068959.2.76553 ENSBTAP00000038013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]