SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038081 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038081
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 1.45e-53
Family C-type lysozyme 0.000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038081   Gene: ENSBTAG00000026779   Transcript: ENSBTAT00000038266
Sequence length 148
Comment pep:known chromosome:UMD3.1:5:44712169:44720976:-1 gene:ENSBTAG00000026779 transcript:ENSBTAT00000038266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQA
TNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPCGALLQDDITQAVACAKRVVSD
PQGIRAWVAWRSHCQNQDLTSYIQGCGV
Download sequence
Identical sequences F2X047 P80189
ENSBTAP00000038081 NP_001071627.1.59421 NP_001071627.1.76553 XP_019816396.1.53367 ENSBTAP00000038081 9913.ENSBTAP00000038081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]