SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039694 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039694
Domain Number 1 Region: 354-503
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000163
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 2 Region: 188-281,335-369
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000574
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039694   Gene: ENSBTAG00000020468   Transcript: ENSBTAT00000039910
Sequence length 533
Comment pep:known chromosome:UMD3.1:27:19168587:19243562:-1 gene:ENSBTAG00000020468 transcript:ENSBTAT00000039910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRRLLWPPPRLPPPCSPHHPAHGPWGRPAGTAPGPPGRPFSCREEDEGAVAEAAWRR
RRRWRELSFAAAAGGGLVGLVCYQLYGDPRADSARAAGPWLPSDSAAAEPEDPPGGGGLF
PIPVAAAKETVAVGRTEVEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEP
KIAKTWKSLSKQELNQMLSETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGF
RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSV
LKTDAEELVSRSYWDTLRRNTSQALFSDFAERADDITNLVTDTTLLVHFFGKKGKAELNF
EDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPE
EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNT
VFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
Download sequence
Identical sequences F1MHU1
ENSBTAP00000039694 XP_005226046.1.76553 XP_005226047.1.76553 ENSBTAP00000039694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]